PDB entry 2hfq

View 2hfq on RCSB PDB site
Description: NMR structure of protein NE1680 from Nitrosomonas europaea: Northeast Structural Genomics Consortium target NeT5
Class: structural genomics, unknown function
Keywords: a/b protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-06-25, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Nitrosomonas europaea [TaxId:915]
  Gene: NE1680
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q82U33 (22-106)
    • see remark 999 (82)
  Domains in SCOPe 2.08: d2hfqa1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hfqA (A:)
  mgsshhhhhhssgrenlyfqghmqihvydtyvkakdghvmhfdvftdvrddkkaiefakq
  wlssigeegatvtseecrfchsekapdevieaikqngyfiykmegcngs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hfqA (A:)
  mqihvydtyvkakdghvmhfdvftdvrddkkaiefakqwlssigeegatvtseecrfchs
  ekapdevieaikqngyfiykmegcn