Lineage for d2hd3i_ (2hd3 I:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 951421Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) (S)
    homohexameric unit
  5. 951422Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins)
    Pfam PF03319
  6. 951442Protein Ethanolamine utilization protein EutN [159135] (1 species)
  7. 951443Species Escherichia coli [TaxId:562] [159136] (2 PDB entries)
    Uniprot P0AEJ9 1-95
  8. 951452Domain d2hd3i_: 2hd3 I: [147264]
    automated match to d2hd3a1

Details for d2hd3i_

PDB Entry: 2hd3 (more details), 2.4 Å

PDB Description: crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
PDB Compounds: (I:) Ethanolamine utilization protein eutN

SCOPe Domain Sequences for d2hd3i_:

Sequence, based on SEQRES records: (download)

>d2hd3i_ b.40.15.1 (I:) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhglahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsg
ssarqahksetspvdlcvigivdevvsggqvifhkle

Sequence, based on observed residues (ATOM records): (download)

>d2hd3i_ b.40.15.1 (I:) Ethanolamine utilization protein EutN {Escherichia coli [TaxId: 562]}
mklavvtgqivctvrhhahdkllmvemidpqgnpdgqcavaidnigagtgewvllvsgss
arqahdlcvigivdevvsggqvifhkle

SCOPe Domain Coordinates for d2hd3i_:

Click to download the PDB-style file with coordinates for d2hd3i_.
(The format of our PDB-style files is described here.)

Timeline for d2hd3i_: