Lineage for d2ha9b2 (2ha9 B:1-440)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097861Family c.7.1.5: SP0239-like [159444] (2 protein domains)
    Pfam PF05167; DUF771
  6. 2097865Protein automated matches [190679] (1 species)
    not a true protein
  7. 2097866Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [187798] (1 PDB entry)
  8. 2097867Domain d2ha9b2: 2ha9 B:1-440 [147252]
    Other proteins in same PDB: d2ha9a1, d2ha9a2, d2ha9b3
    automated match to d2ha9a1

Details for d2ha9b2

PDB Entry: 2ha9 (more details), 2.7 Å

PDB Description: Crystal structure of protein SP0239 from Streptococcus pneumoniae
PDB Compounds: (B:) UPF0210 protein SP0239

SCOPe Domain Sequences for d2ha9b2:

Sequence, based on SEQRES records: (download)

>d2ha9b2 c.7.1.5 (B:1-440) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mdirqvtetiamieeqnfdirtitmgislldcidpdinraaekiyqkittkaanlvavgd
eiaaelgipivnkrvsvtpisligaatdatdyvvlakaldkaakeigvdfiggfsalvqk
gyqkgdeilinsipralaetdkvcssvnigstksginmtavadmgriiketanlsdmgva
klvvfanavednpfmagafhgvgeadviinvgvsgpgvvkralekvrgqsfdvvaetvkk
tafkitrigqlvgqmaserlgvefgivdlslaptpavgdsvarvleemgletvgthgtta
alallndqvkkggvmacnqvgglsgafipvsedegmiaavqngslnlekleamtaicsvg
ldmiaipedtpaetiaamiadeaaigvinmkttavriipkgkegdmiefggllgtapvmk
vngassvdfisrggqipapi

Sequence, based on observed residues (ATOM records): (download)

>d2ha9b2 c.7.1.5 (B:1-440) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mdirqvtetiamieeqnfdirtitmgislldcidpdinraaekiyqkittkaanlvavgd
eiaaelgipivnkrvsvtpisligaatdatdyvvlakaldkaakeigvdfiggfsalvqk
gyqkgdeilinsipralaetdkvcssvnigstksginmtavadmgriiketanlsdmgva
klvvfanavdnpmagafhgvgeadviinvgvsgpgvvkralekvrgqsfdvvaetvkkta
fkitrigqlvgqmaserlgvefgivdlslapvgdsvarvleemgletvgthgttaalall
ndqvkkggvmacnqedegmiaavqngslnlekleamtaicsdmiaipedtpaetiaamia
deaaigvinmkttavriipkgkegdmiefapvmkvngassvdfisrggqipapi

SCOPe Domain Coordinates for d2ha9b2:

Click to download the PDB-style file with coordinates for d2ha9b2.
(The format of our PDB-style files is described here.)

Timeline for d2ha9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ha9b3