Lineage for d2ha9a1 (2ha9 A:1-440)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097861Family c.7.1.5: SP0239-like [159444] (2 protein domains)
    Pfam PF05167; DUF771
  6. 2097862Protein Uncharacterized protein SP0239 [159445] (1 species)
  7. 2097863Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159446] (1 PDB entry)
    Uniprot Q97ST4 1-440
  8. 2097864Domain d2ha9a1: 2ha9 A:1-440 [147251]
    Other proteins in same PDB: d2ha9a2, d2ha9b2, d2ha9b3

Details for d2ha9a1

PDB Entry: 2ha9 (more details), 2.7 Å

PDB Description: Crystal structure of protein SP0239 from Streptococcus pneumoniae
PDB Compounds: (A:) UPF0210 protein SP0239

SCOPe Domain Sequences for d2ha9a1:

Sequence, based on SEQRES records: (download)

>d2ha9a1 c.7.1.5 (A:1-440) Uncharacterized protein SP0239 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mdirqvtetiamieeqnfdirtitmgislldcidpdinraaekiyqkittkaanlvavgd
eiaaelgipivnkrvsvtpisligaatdatdyvvlakaldkaakeigvdfiggfsalvqk
gyqkgdeilinsipralaetdkvcssvnigstksginmtavadmgriiketanlsdmgva
klvvfanavednpfmagafhgvgeadviinvgvsgpgvvkralekvrgqsfdvvaetvkk
tafkitrigqlvgqmaserlgvefgivdlslaptpavgdsvarvleemgletvgthgtta
alallndqvkkggvmacnqvgglsgafipvsedegmiaavqngslnlekleamtaicsvg
ldmiaipedtpaetiaamiadeaaigvinmkttavriipkgkegdmiefggllgtapvmk
vngassvdfisrggqipapi

Sequence, based on observed residues (ATOM records): (download)

>d2ha9a1 c.7.1.5 (A:1-440) Uncharacterized protein SP0239 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mdirqvtetiamieeqnfdirtitmgislldcidpdinraaekiyqkittkaanlvavgd
eiaaelgipivnkrvsvtpisligaatdatdyvvlakaldkaakeigvdfiggfsalvqk
gyqkgdeilinsipralaetdkvcssvnigstksginmtavadmgriiketanlsdmgva
klvvfanavednpfmaafhgvgeadviinvgvsgpgvvkralekvrgqsfdvvaetvkkt
afkitrigqlvgqmaserlgvefgivdlslaptdsvarvleemgletvgthgttaalall
ndqvkkggvmacndegmiaavqngslnlekleamtaicsdmiaipedtpaetiaamiade
aaigvinmkttavriipkgkegdmieftapvmkvngassvdfisrggqipapi

SCOPe Domain Coordinates for d2ha9a1:

Click to download the PDB-style file with coordinates for d2ha9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ha9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ha9a2