Lineage for d2h3ka1 (2h3k A:1-144)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376607Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2376608Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2376622Protein Iron-regulated surface determinant protein H, IsdH [158917] (1 species)
  7. 2376623Species Staphylococcus aureus [TaxId:1280] [158918] (2 PDB entries)
    Uniprot Q6G8J7 86-229
  8. 2376630Domain d2h3ka1: 2h3k A:1-144 [147218]

Details for d2h3ka1

PDB Entry: 2h3k (more details)

PDB Description: solution structure of the first neat domain of isdh
PDB Compounds: (A:) Haptoglobin-binding surface anchored protein

SCOPe Domain Sequences for d2h3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3ka1 b.1.28.1 (A:1-144) Iron-regulated surface determinant protein H, IsdH {Staphylococcus aureus [TaxId: 1280]}
adeslkdaikdpalenkehdigpreqvnfqlldknnetqyyhffsikdpadvyytkkkae
veldintastwkkfevyennqklpvrlvsyspvpedhayirfpvsdgtqelkivsstqid
dgeetnydytklvfakpiyndpsl

SCOPe Domain Coordinates for d2h3ka1:

Click to download the PDB-style file with coordinates for d2h3ka1.
(The format of our PDB-style files is described here.)

Timeline for d2h3ka1: