SCOPe 2.06: Domain d2gina_: 2gin A:

Lineage for d2gina_ (2gin A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
   Uniprot Q9LS02 80-253

8. Domain d2gina_: 2gin A: [147116]
   automated match to d1z8ka1
   complexed with gol, na

Details for d2gina_

PDB Entry: 2gin, 1.8 Å

PDB Description: X-ray structure of the wt allene oxide cyclase 2 from arabidopsis thaliana

PDB Compounds: (A:) Allene oxide cyclase 2

SCOPe Domain Sequences for d2gina_:

Sequence; same for both SEQRES and ATOM records:

>d2gina_ b.159.1.1 (A:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d2gina_:

• d2gina_ first appeared in SCOP 1.75, called d2gina1
  
• d2gina_ appears in SCOPe 2.05
  
• d2gina_ appears in SCOPe 2.07
  
• d2gina_ appears in the current release, SCOPe 2.08