Lineage for d2geya1 (2gey A:2-145)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641284Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)
  6. 1641295Protein Putative hydroxylase AclR [159969] (1 species)
  7. 1641296Species Streptomyces galilaeus [TaxId:33899] [159970] (1 PDB entry)
    Uniprot Q1XDX7 2-145
  8. 1641297Domain d2geya1: 2gey A:2-145 [147114]
    complexed with gol, peg, pg4

Details for d2geya1

PDB Entry: 2gey (more details), 1.8 Å

PDB Description: Crystal Structure of AclR a putative hydroxylase from Streptomyces galilaeus
PDB Compounds: (A:) AclR protein

SCOPe Domain Sequences for d2geya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}
smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
nmrpllvrlgklpdvpkvvleasa

SCOPe Domain Coordinates for d2geya1:

Click to download the PDB-style file with coordinates for d2geya1.
(The format of our PDB-style files is described here.)

Timeline for d2geya1: