SCOPe 2.06: Domain d2gaxa1: 2gax A:1-135

Lineage for d2gaxa1 (2gax A:1-135)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest

4. Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families)

5. Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
   Pfam PF01981; UPF0099

6. Protein Hypothetical protein Atu0240 [159592] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159593] (1 PDB entry)
   Uniprot Q8UIQ3 1-135

8. Domain d2gaxa1: 2gax A:1-135 [147100]
   complexed with po4

Details for d2gaxa1

PDB Entry: 2gax, 1.8 Å

PDB Description: structure of protein of unknown function atu0240 from agrobacteriium tumerfaciencs str. c58

PDB Compounds: (A:) hypothetical protein Atu0240

SCOPe Domain Sequences for d2gaxa1:

Sequence; same for both SEQRES and ATOM records:

>d2gaxa1 c.131.1.1 (A:1-135) Hypothetical protein Atu0240 {Agrobacterium tumefaciens [TaxId: 358]}
mfdtkiavilrddlavwqklnvtaflmsgivaqtgeiigepyrdgagnvynplsiqpivv
matdqealrkihqrslerdittslyieemfatghdaanrqvfshfspdtakvvgmalrad
rkivdkitkgaklha

Timeline for d2gaxa1:

• d2gaxa1 first appeared in SCOP 1.75
  
• d2gaxa1 appears in SCOPe 2.05
  
• d2gaxa1 appears in SCOPe 2.07
  
• d2gaxa1 appears in the current release, SCOPe 2.08