Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) |
Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins) Pfam PF01981; UPF0099 |
Protein Hypothetical protein Atu0240 [159592] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [159593] (1 PDB entry) Uniprot Q8UIQ3 1-135 |
Domain d2gaxa1: 2gax A:1-135 [147100] complexed with po4 |
PDB Entry: 2gax (more details), 1.8 Å
SCOPe Domain Sequences for d2gaxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gaxa1 c.131.1.1 (A:1-135) Hypothetical protein Atu0240 {Agrobacterium tumefaciens [TaxId: 358]} mfdtkiavilrddlavwqklnvtaflmsgivaqtgeiigepyrdgagnvynplsiqpivv matdqealrkihqrslerdittslyieemfatghdaanrqvfshfspdtakvvgmalrad rkivdkitkgaklha
Timeline for d2gaxa1: