Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) |
Domain d2g75d2: 2g75 D:109-211 [147093] Other proteins in same PDB: d2g75a1, d2g75a2, d2g75a3, d2g75b1, d2g75c1, d2g75c2, d2g75c3, d2g75d1 automated match to d2dd8l2 |
PDB Entry: 2g75 (more details), 2.28 Å
SCOPe Domain Sequences for d2g75d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g75d2 b.1.1.2 (D:109-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d2g75d2: