![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
![]() | Domain d2g75d2: 2g75 D:109-211 [147093] Other proteins in same PDB: d2g75a1, d2g75a2, d2g75b1, d2g75c1, d2g75c2, d2g75d1 automatically matched to 2DD8 L:109-213 |
PDB Entry: 2g75 (more details), 2.28 Å
SCOP Domain Sequences for d2g75d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g75d2 b.1.1.2 (D:109-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d2g75d2: