Lineage for d2g3wb_ (2g3w B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604615Family c.52.1.33: YaeQ-like [159605] (2 proteins)
    Pfam PF07152; contains extra N- and C-terminal beta-structures forming additional five-stranded beta-sheet; retains the PD motif in the putative active site
  6. 1604619Protein Hypothetical protein XAC2396 [159606] (1 species)
  7. 1604620Species Xanthomonas axonopodis pv. citri [TaxId:92829] [159607] (1 PDB entry)
    Uniprot Q8PJY1 4-182
  8. 1604622Domain d2g3wb_: 2g3w B: [147078]
    automated match to d2g3wa1
    complexed with act

Details for d2g3wb_

PDB Entry: 2g3w (more details), 1.9 Å

PDB Description: The Crystal Structure of YaeQ Protein from Xanthomonas axonopodis pv. citri
PDB Compounds: (B:) hypothetical protein XAC2396

SCOPe Domain Sequences for d2g3wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3wb_ c.52.1.33 (B:) Hypothetical protein XAC2396 {Xanthomonas axonopodis pv. citri [TaxId: 92829]}
tatvrraelqisdmdrgyyanhsltlaqhpsetderlmvrllafalfaddrlefgrglsn
ddepdlwrrdytgdpdlwidlgqpdesrvrkacnrsreavvigyggqatetwwkkhanam
gryrnlrvieldsqatealgaliqrgmrfdviiqdgevqmladhgsvtltpmvrqap

SCOPe Domain Coordinates for d2g3wb_:

Click to download the PDB-style file with coordinates for d2g3wb_.
(The format of our PDB-style files is described here.)

Timeline for d2g3wb_: