Lineage for d2fhca5 (2fhc A:403-965)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. Protein Pullulanase PulA [159381] (1 species)
  7. Species Klebsiella pneumoniae [TaxId:573] [159382] (6 PDB entries)
    Uniprot P07206 410-972
  8. Domain d2fhca5: 2fhc A:403-965 [147034]
    Other proteins in same PDB: d2fhca1, d2fhca2, d2fhca3, d2fhca4
    automated match to d2fhfa5
    complexed with ca

    has additional subdomain(s) that are not in the common domain

Details for d2fhca5

PDB Entry: 2fhc (more details), 1.85 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotriose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhca5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhca5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
pegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvqh
lkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsgs
tveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsyatdpegtarik
efrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesat
ccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsawerikalnpdiy
ffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsga
gvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseidyngapggyaad
ptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqgiafdqqgsell
rsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvkdavatpgetel
kqmtafyqeltalrkssplftlg

SCOPe Domain Coordinates for d2fhca5 are not available.

Timeline for d2fhca5:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhca1, d2fhca2, d2fhca3, d2fhca4