SCOPe 2.04: Domain d2elcc1: 2elc C:1-65

Lineage for d2elcc1 (2elc C:1-65)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Thermus thermophilus [TaxId:274] [101213] (2 PDB entries)

8. Domain d2elcc1: 2elc C:1-65 [146901]
   Other proteins in same PDB: d2elca2, d2elcb2, d2elcc2, d2elcd2
   automated match to d1v8ga1
   complexed with gol, na

Details for d2elcc1

PDB Entry: 2elc, 1.55 Å

PDB Description: Crystal structure of TTHA1842 from Thermus thermophilus HB8

PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d2elcc1:

Sequence; same for both SEQRES and ATOM records:

>d2elcc1 a.46.2.1 (C:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]}
mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
eaarp

Timeline for d2elcc1:

• d2elcc1 first appeared in SCOP 1.75
  
• d2elcc1 appears in SCOPe 2.03
  
• d2elcc1 appears in SCOPe 2.05
  
• d2elcc1 appears in the current release, SCOPe 2.08