Lineage for d2ejfb2 (2ejf B:1-188)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920933Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 1920942Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 1920943Species Pyrococcus horikoshii [TaxId:53953] [143641] (26 PDB entries)
    Uniprot O57883 1-188
  8. 1920989Domain d2ejfb2: 2ejf B:1-188 [146874]
    Other proteins in same PDB: d2ejfa1, d2ejfb1
    automated match to d2zgwa2
    complexed with adn, btn, gol; mutant

Details for d2ejfb2

PDB Entry: 2ejf (more details), 2 Å

PDB Description: crystal structure of the biotin protein ligase (mutations r48a and k111a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
PDB Compounds: (B:) 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2ejfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ejfb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d2ejfb2:

Click to download the PDB-style file with coordinates for d2ejfb2.
(The format of our PDB-style files is described here.)

Timeline for d2ejfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ejfb1