Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins) |
Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries) Uniprot O57883 1-188 |
Domain d2ejfb2: 2ejf B:1-188 [146874] Other proteins in same PDB: d2ejfa1, d2ejfb1 automatically matched to 2ZGW A:1-188 complexed with adn, btn, gol; mutant |
PDB Entry: 2ejf (more details), 2 Å
SCOP Domain Sequences for d2ejfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ejfb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d2ejfb2: