Lineage for d2e9ta_ (2e9t A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1952391Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1952399Protein Viral RNA polymerase [56695] (17 species)
  7. 1952419Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries)
    Uniprot Q9QCE4 1858-2327
  8. 1952424Domain d2e9ta_: 2e9t A: [146733]
    automated match to d1u09a_
    protein/RNA complex; complexed with mg, ppv

Details for d2e9ta_

PDB Entry: 2e9t (more details), 2.6 Å

PDB Description: Foot-and-mouth disease virus RNA-polymerase RNA dependent in complex with a template-primer RNA and 5F-UTP
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d2e9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9ta_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaale

SCOPe Domain Coordinates for d2e9ta_:

Click to download the PDB-style file with coordinates for d2e9ta_.
(The format of our PDB-style files is described here.)

Timeline for d2e9ta_: