Lineage for d2e8aa1 (2e8a A:3-188)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372597Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 1372678Species Human (Homo sapiens) [TaxId:9606] [53071] (6 PDB entries)
  8. 1372679Domain d2e8aa1: 2e8a A:3-188 [146724]
    automatically matched to d1hjoa1
    complexed with anp, mg

Details for d2e8aa1

PDB Entry: 2e8a (more details), 1.77 Å

PDB Description: Crystal structure of the human Hsp70 ATPase domain in complex with AMP-PNP
PDB Compounds: (A:) Heat shock 70kDa protein 1A

SCOPe Domain Sequences for d2e8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e8aa1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldrt

SCOPe Domain Coordinates for d2e8aa1:

Click to download the PDB-style file with coordinates for d2e8aa1.
(The format of our PDB-style files is described here.)

Timeline for d2e8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e8aa2