SCOPe 2.08: Domain d2e8aa1: 2e8a A:3-187

Lineage for d2e8aa1 (2e8a A:3-187)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d2e8aa1: 2e8a A:3-187 [146724]
   automated match to d3iucc1
   complexed with anp, mg

Details for d2e8aa1

PDB Entry: 2e8a, 1.77 Å

PDB Description: Crystal structure of the human Hsp70 ATPase domain in complex with AMP-PNP

PDB Compounds: (A:) Heat shock 70kDa protein 1A

SCOPe Domain Sequences for d2e8aa1:

Sequence; same for both SEQRES and ATOM records:

>d2e8aa1 c.55.1.0 (A:3-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldr

Timeline for d2e8aa1:

• d2e8aa1 first appeared in SCOP 1.75
  
• d2e8aa1 appears in SCOPe 2.07