Lineage for d2e8aa1 (2e8a A:3-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885066Domain d2e8aa1: 2e8a A:3-187 [146724]
    automated match to d3iucc1
    complexed with anp, mg

Details for d2e8aa1

PDB Entry: 2e8a (more details), 1.77 Å

PDB Description: Crystal structure of the human Hsp70 ATPase domain in complex with AMP-PNP
PDB Compounds: (A:) Heat shock 70kDa protein 1A

SCOPe Domain Sequences for d2e8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e8aa1 c.55.1.0 (A:3-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvaln
pqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissm
vltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaia
ygldr

SCOPe Domain Coordinates for d2e8aa1:

Click to download the PDB-style file with coordinates for d2e8aa1.
(The format of our PDB-style files is described here.)

Timeline for d2e8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e8aa2