![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins) |
![]() | Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [143641] (26 PDB entries) Uniprot O57883 1-188 |
![]() | Domain d2e64b2: 2e64 B:1-188 [146700] Other proteins in same PDB: d2e64a1, d2e64b1 automated match to d2zgwa2 mutant |
PDB Entry: 2e64 (more details), 1.5 Å
SCOPe Domain Sequences for d2e64b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e64b2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln lvrdnmil
Timeline for d2e64b2: