SCOP 1.75: Domain d2e64b2: 2e64 B:1-188

Lineage for d2e64b2 (2e64 B:1-188)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries)
   Uniprot O57883 1-188

8. Domain d2e64b2: 2e64 B:1-188 [146700]
   Other proteins in same PDB: d2e64a1, d2e64b1
   automatically matched to 2ZGW A:1-188
   mutant

Details for d2e64b2

PDB Entry: 2e64, 1.5 Å

PDB Description: crystal structure of biotin protein ligase from pyrococcus horikoshii, mutations r48a and k111a

PDB Compounds: (B:) biotin--[acetyl-CoA-carboxylase] ligase

SCOP Domain Sequences for d2e64b2:

Sequence; same for both SEQRES and ATOM records:

>d2e64b2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d2e64b2:

• d2e64b2 is new in SCOP 1.75
  
• d2e64b2 appears in SCOPe 2.01
  
• d2e64b2 appears in the current release, SCOPe 2.08