Lineage for d2e21d2 (2e21 D:217-311)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051613Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
    beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432
  4. 1051614Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) (S)
  5. 1051615Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)
  6. 1051616Protein TilS-like protein Aq_1887 [143132] (1 species)
    lacks the C-terminal domain of the E. coli homologue
  7. 1051617Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
    Uniprot O67728 217-311
  8. 1051627Domain d2e21d2: 2e21 D:217-311 [146642]
    Other proteins in same PDB: d2e21a1, d2e21b1, d2e21c1, d2e21d1
    automatically matched to d1wy5a2
    complexed with anp

Details for d2e21d2

PDB Entry: 2e21 (more details), 2.7 Å

PDB Description: Crystal structure of TilS in a complex with AMPPNP from Aquifex aeolicus.
PDB Compounds: (D:) tRNA(Ile)-lysidine synthase

SCOPe Domain Sequences for d2e21d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e21d2 d.229.1.1 (D:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwl

SCOPe Domain Coordinates for d2e21d2:

Click to download the PDB-style file with coordinates for d2e21d2.
(The format of our PDB-style files is described here.)

Timeline for d2e21d2: