| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.2: Acetokinase-like [53080] (3 proteins) |
| Protein Propionate kinase [142462] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [142463] (5 PDB entries) Uniprot O06961 193-397! Uniprot O06961 4-192 |
| Domain d2e1za1: 2e1z A:4-192 [146631] automatically matched to d1x3ma2 complexed with b4p, edo |
PDB Entry: 2e1z (more details), 1.98 Å
SCOPe Domain Sequences for d2e1za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e1za1 c.55.1.2 (A:4-192) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
fpvvlvincgsssikfsvldvatcdvlmagiadgmntenaflsingdkpinlahsnyeda
lkaiafelekrdltdsvalighriahggelftqsviitdeiidnirrvsplaplhnyanl
sgidaarhlfpavrqvavfdtsfhqtlapeaylyglpweyfsslgvrrygfhgtshryvs
rrayelldl
Timeline for d2e1za1: