SCOPe 2.07: Domain d2dt7b1: 2dt7 B:134-217

Lineage for d2dt7b1 (2dt7 B:134-217)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
   5 helices: irregular array

4. Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family)

5. Family a.217.1.1: Surp module (SWAP domain) [109906] (3 proteins)
   Pfam PF01805

6. Protein Splicing factor 3 subunit 1, SF3A1 [158612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158613] (2 PDB entries)
   Uniprot Q15459 134-217! Uniprot Q15459 48-110

8. Domain d2dt7b1: 2dt7 B:134-217 [146576]
   Other proteins in same PDB: d2dt7b2
   2nd SURP domain complexed with an alpha-helical fragment of Splicing factor 3a subunit 3 (chain A)
   protein/RNA complex

Details for d2dt7b1

PDB Entry: 2dt7

PDB Description: solution structure of the second surp domain of human splicing factor sf3a120 in complex with a fragment of human splicing factor sf3a60

PDB Compounds: (B:) Splicing factor 3 subunit 1

SCOPe Domain Sequences for d2dt7b1:

Sequence; same for both SEQRES and ATOM records:

>d2dt7b1 a.217.1.1 (B:134-217) Splicing factor 3 subunit 1, SF3A1 {Human (Homo sapiens) [TaxId: 9606]}
aqviqetivpkepppefefiadppsisafdldvvkltaqfvarngrqfltqlmqkeqrny
qfdflrpqhslfnyftklveqytk

Timeline for d2dt7b1:

• d2dt7b1 first appeared in SCOP 1.75
  
• d2dt7b1 appears in SCOPe 2.06
  
• d2dt7b1 appears in the current release, SCOPe 2.08