![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.174: YopT-like [159221] (1 superfamily) beta-sheet barrel, closed, n=6, S=12, capped at both ends by helices; intertwined dimer of beta-alpha-beta(2) subinits; |
![]() | Superfamily b.174.1: YopT-like [159222] (1 family) ![]() automatically mapped to Pfam PF09467 |
![]() | Family b.174.1.1: YopT-like [159223] (2 proteins) Pfam PF09467 |
![]() | Protein automated matches [190604] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [187624] (1 PDB entry) |
![]() | Domain d2dlbb_: 2dlb B: [146542] Other proteins in same PDB: d2dlba1 automated match to d2dlba1 |
PDB Entry: 2dlb (more details), 1.2 Å
SCOPe Domain Sequences for d2dlbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlbb_ b.174.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} agylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdme yeitnteelp
Timeline for d2dlbb_: