SCOPe 2.07: Domain d2dlbb_: 2dlb B:

Lineage for d2dlbb_ (2dlb B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.174: YopT-like [159221] (1 superfamily)
   beta-sheet barrel, closed, n=6, S=12, capped at both ends by helices; intertwined dimer of beta-alpha-beta(2) subinits;

4. Superfamily b.174.1: YopT-like [159222] (1 family)
   automatically mapped to Pfam PF09467

5. Family b.174.1.1: YopT-like [159223] (2 proteins)
   Pfam PF09467

6. Protein automated matches [190604] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187624] (1 PDB entry)

8. Domain d2dlbb_: 2dlb B: [146542]
   Other proteins in same PDB: d2dlba1
   automated match to d2dlba1

Details for d2dlbb_

PDB Entry: 2dlb, 1.2 Å

PDB Description: X-ray Crystal Structure of Protein yopT from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR412

PDB Compounds: (B:) yopT

SCOPe Domain Sequences for d2dlbb_:

Sequence; same for both SEQRES and ATOM records:

>d2dlbb_ b.174.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
agylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdme
yeitnteelp

Timeline for d2dlbb_:

• d2dlbb_ first appeared in SCOP 1.75, called d2dlbb1
  
• d2dlbb_ appears in SCOPe 2.06
  
• d2dlbb_ appears in the current release, SCOPe 2.08