Lineage for d2djaa1 (2dja A:8-78)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037487Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 3037488Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 3037489Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 3037493Protein Midline-2 [161192] (1 species)
  7. 3037494Species Human (Homo sapiens) [TaxId:9606] [161193] (1 PDB entry)
    Uniprot Q9UJV3 162-232
  8. 3037495Domain d2djaa1: 2dja A:8-78 [146530]
    Other proteins in same PDB: d2djaa2, d2djaa3
    complexed with zn

Details for d2djaa1

PDB Entry: 2dja (more details)

PDB Description: solution structure of the b-box domain of the human midline-2 protein
PDB Compounds: (A:) Midline-2

SCOPe Domain Sequences for d2djaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]}
vepvpdthlrgitcldhenekvnmycvsddqlicalcklvgrhrdhqvaslndrfeklkq
tlemnltnlvk

SCOPe Domain Coordinates for d2djaa1:

Click to download the PDB-style file with coordinates for d2djaa1.
(The format of our PDB-style files is described here.)

Timeline for d2djaa1: