Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.374: TTHC002-like [160760] (1 superfamily) alpha-beta-alpha-beta(3); forms dimer with a single beta-sheet, folded in a barrel-like shape |
Superfamily d.374.1: TTHC002-like [160761] (1 family) |
Family d.374.1.1: TTHC002-like [160762] (1 protein) |
Protein Hypothetical protein TTHC002 [160763] (1 species) |
Species Thermus thermophilus [TaxId:274] [160764] (1 PDB entry) Uniprot Q5SGN2 7-86 |
Domain d2dbsb_: 2dbs B: [146484] automated match to d2dbsa1 |
PDB Entry: 2dbs (more details), 2.1 Å
SCOPe Domain Sequences for d2dbsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dbsb_ d.374.1.1 (B:) Hypothetical protein TTHC002 {Thermus thermophilus [TaxId: 274]} paerlaeldgvlmqylleadllrelpptyrlvllpldepevaaqalawameapnpegwps vyalflqgrpirllllgkevev
Timeline for d2dbsb_: