SCOPe 2.08: Domain d2dbsb_: 2dbs B:

Lineage for d2dbsb_ (2dbs B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.374: TTHC002-like [160760] (1 superfamily)
   alpha-beta-alpha-beta(3); forms dimer with a single beta-sheet, folded in a barrel-like shape

4. Superfamily d.374.1: TTHC002-like [160761] (1 family)

5. Family d.374.1.1: TTHC002-like [160762] (1 protein)

6. Protein Hypothetical protein TTHC002 [160763] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160764] (1 PDB entry)
   Uniprot Q5SGN2 7-86

8. Domain d2dbsb_: 2dbs B: [146484]
   automated match to d2dbsa1

Details for d2dbsb_

PDB Entry: 2dbs, 2.1 Å

PDB Description: crystal structure of a hypothetical protein tthc002 from thermus thermophilus hb8

PDB Compounds: (B:) hypothetical protein TTHC002

SCOPe Domain Sequences for d2dbsb_:

Sequence; same for both SEQRES and ATOM records:

>d2dbsb_ d.374.1.1 (B:) Hypothetical protein TTHC002 {Thermus thermophilus [TaxId: 274]}
paerlaeldgvlmqylleadllrelpptyrlvllpldepevaaqalawameapnpegwps
vyalflqgrpirllllgkevev

Timeline for d2dbsb_:

• d2dbsb_ first appeared in SCOP 1.75, called d2dbsb1
  
• d2dbsb_ appears in SCOPe 2.07