SCOPe 2.08: Domain d2dbsa1: 2dbs A:7-86

Lineage for d2dbsa1 (2dbs A:7-86)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.374: TTHC002-like [160760] (1 superfamily)
   alpha-beta-alpha-beta(3); forms dimer with a single beta-sheet, folded in a barrel-like shape

4. Superfamily d.374.1: TTHC002-like [160761] (1 family)

5. Family d.374.1.1: TTHC002-like [160762] (1 protein)

6. Protein Hypothetical protein TTHC002 [160763] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160764] (1 PDB entry)
   Uniprot Q5SGN2 7-86

8. Domain d2dbsa1: 2dbs A:7-86 [146483]

Details for d2dbsa1

PDB Entry: 2dbs, 2.1 Å

PDB Description: crystal structure of a hypothetical protein tthc002 from thermus thermophilus hb8

PDB Compounds: (A:) hypothetical protein TTHC002

SCOPe Domain Sequences for d2dbsa1:

Sequence; same for both SEQRES and ATOM records:

>d2dbsa1 d.374.1.1 (A:7-86) Hypothetical protein TTHC002 {Thermus thermophilus [TaxId: 274]}
rlaeldgvlmqylleadllrelpptyrlvllpldepevaaqalawameapnpegwpsvya
lflqgrpirllllgkeveva

Timeline for d2dbsa1:

• d2dbsa1 first appeared in SCOP 1.75
  
• d2dbsa1 appears in SCOPe 2.07