Lineage for d2dawa1 (2daw A:8-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939430Family d.20.1.3: RWD domain [110843] (4 proteins)
    Pfam PF05773
  6. 2939438Protein RWD domain-containing protein 2 [160085] (1 species)
  7. 2939439Species Human (Homo sapiens) [TaxId:9606] [160086] (1 PDB entry)
    Uniprot Q9UIY3 1-141
  8. 2939440Domain d2dawa1: 2daw A:8-148 [146477]
    Other proteins in same PDB: d2dawa2, d2dawa3

Details for d2dawa1

PDB Entry: 2daw (more details)

PDB Description: solution structure of the rwd domain of human rwd omain containing protein 2
PDB Compounds: (A:) RWD domain containing protein 2

SCOPe Domain Sequences for d2dawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]}
msasvkeslqlqllememlfsmfpnqgevkledvnaltnikrylegtrealppkiefvit
lqieepkvkidlqvtmphsypylalqlfgrsseldrhqqlllnkgltsyigtfdpgelcv
caaiqwlqdnsasyflnrklv

SCOPe Domain Coordinates for d2dawa1:

Click to download the PDB-style file with coordinates for d2dawa1.
(The format of our PDB-style files is described here.)

Timeline for d2dawa1: