Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.3: RWD domain [110843] (4 proteins) Pfam PF05773 |
Protein RWD domain-containing protein 2 [160085] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160086] (1 PDB entry) Uniprot Q9UIY3 1-141 |
Domain d2dawa1: 2daw A:8-148 [146477] Other proteins in same PDB: d2dawa2, d2dawa3 |
PDB Entry: 2daw (more details)
SCOPe Domain Sequences for d2dawa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} msasvkeslqlqllememlfsmfpnqgevkledvnaltnikrylegtrealppkiefvit lqieepkvkidlqvtmphsypylalqlfgrsseldrhqqlllnkgltsyigtfdpgelcv caaiqwlqdnsasyflnrklv
Timeline for d2dawa1: