Lineage for d2d5rb1 (2d5r B:24-139)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1689769Fold d.370: BTG domain-like [160695] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); four-helical bundle, capped at one end by an antiparallel beta-sheet, order:1234
  4. 1689770Superfamily d.370.1: BTG domain-like [160696] (1 family) (S)
    automatically mapped to Pfam PF07742
  5. 1689771Family d.370.1.1: BTG domain-like [160697] (3 proteins)
    Pfam PF07742
  6. 1689775Protein TOB1, N-terminal domain [160698] (1 species)
  7. 1689776Species Human (Homo sapiens) [TaxId:9606] [160699] (2 PDB entries)
    Uniprot P50616 1-115! Uniprot P50616 1-117
  8. 1689781Domain d2d5rb1: 2d5r B:24-139 [146467]
    Other proteins in same PDB: d2d5ra1

Details for d2d5rb1

PDB Entry: 2d5r (more details), 2.5 Å

PDB Description: Crystal Structure of a Tob-hCaf1 Complex
PDB Compounds: (B:) Tob1 protein

SCOPe Domain Sequences for d2d5rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5rb1 d.370.1.1 (B:24-139) TOB1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hmqleiqvalnfiisylynklprrrvnifgeelerllkkkyeghwypekpykgsgfrcih
igekvdpvieqaskesgldiddvrgnlpqdlsvwidpfevsyqigekgpvkvlyvd

SCOPe Domain Coordinates for d2d5rb1:

Click to download the PDB-style file with coordinates for d2d5rb1.
(The format of our PDB-style files is described here.)

Timeline for d2d5rb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d5ra1