![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.3: MoaD/ThiS [54285] (5 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.3.2: ThiS [54289] (5 proteins) |
![]() | Protein Uncharacterised protein TTHA0675 [159929] (1 species) probable ThiS homologue |
![]() | Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries) Uniprot Q5SKG8 1-63 |
![]() | Domain d2cu3b_: 2cu3 B: [146429] automated match to d2cu3a1 complexed with cd |
PDB Entry: 2cu3 (more details), 1.7 Å
SCOPe Domain Sequences for d2cu3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu3b_ d.15.3.2 (B:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval mqgg
Timeline for d2cu3b_: