SCOPe 2.08: Domain d2cu3b_: 2cu3 B:

Lineage for d2cu3b_ (2cu3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.2: ThiS [54289] (5 proteins)

6. Protein Uncharacterised protein TTHA0675 [159929] (1 species)
   probable ThiS homologue

7. Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
   Uniprot Q5SKG8 1-63

8. Domain d2cu3b_: 2cu3 B: [146429]
   automated match to d2cu3a1
   complexed with cd

Details for d2cu3b_

PDB Entry: 2cu3, 1.7 Å

PDB Description: Crystal structure of TT1568 from Thermus thermophilus HB8

PDB Compounds: (B:) unknown function protein

SCOPe Domain Sequences for d2cu3b_:

Sequence; same for both SEQRES and ATOM records:

>d2cu3b_ d.15.3.2 (B:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqgg

Timeline for d2cu3b_:

• d2cu3b_ first appeared in SCOP 1.75, called d2cu3b1
  
• d2cu3b_ appears in SCOPe 2.07