PDB entry 2cu3

View 2cu3 on RCSB PDB site
Description: Crystal structure of TT1568 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Thermus thermophilus HB8, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, UNKNOWN FUNCTION
Deposited on 2005-05-25, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.224
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: unknown function protein
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72KL7 (0-End)
  Domains in SCOPe 2.08: d2cu3a1
• Chain 'B':
  Compound: unknown function protein
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72KL7 (0-63)
  Domains in SCOPe 2.08: d2cu3b_
• Heterogens: CD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2cu3A (A:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2cu3A (A:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cu3B (B:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqgg