![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.4: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain [159283] (1 family) ![]() probable rudiment form of the LpxA-like hexapeptide domain |
![]() | Family b.81.4.1: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain [159284] (1 protein) corresponds to the N-terminal part of Pfam PF01050, but does not extend to the conserved functional motif; the predicted cupin fold may reside in the rest of the Pfam domain this is a repeat family; one repeat unit is 2cu2 A:288-305 found in domain |
![]() | Protein Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 [159285] (1 species) there is no the functional mannose-6-phosphate isomerase domain in this protein; this would-be the linker domain is the C-terminal one |
![]() | Species Thermus thermophilus [TaxId:274] [159286] (1 PDB entry) Uniprot Q5SHI0 269-335 |
![]() | Domain d2cu2a1: 2cu2 A:269-335 [146426] Other proteins in same PDB: d2cu2a2 complexed with so4 |
PDB Entry: 2cu2 (more details), 2.2 Å
SCOPe Domain Sequences for d2cu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu2a1 b.81.4.1 (A:269-335) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} dphenvvlgegrhvaldtfgcvvyadrgvvatlgvsglvvakvgdevlvvpkdwarevre vvkrlea
Timeline for d2cu2a1: