Lineage for d2cu2a1 (2cu2 A:269-335)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2070009Superfamily b.81.4: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain [159283] (1 family) (S)
    probable rudiment form of the LpxA-like hexapeptide domain
  5. 2070010Family b.81.4.1: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain [159284] (1 protein)
    corresponds to the N-terminal part of Pfam PF01050, but does not extend to the conserved functional motif; the predicted cupin fold may reside in the rest of the Pfam domain
  6. 2070011Protein Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 [159285] (1 species)
    there is no the functional mannose-6-phosphate isomerase domain in this protein; this would-be the linker domain is the C-terminal one
  7. 2070012Species Thermus thermophilus [TaxId:274] [159286] (1 PDB entry)
    Uniprot Q5SHI0 269-335
  8. 2070013Domain d2cu2a1: 2cu2 A:269-335 [146426]
    Other proteins in same PDB: d2cu2a2
    complexed with so4

Details for d2cu2a1

PDB Entry: 2cu2 (more details), 2.2 Å

PDB Description: Crystal structure of mannose-1-phosphate geranyltransferase from Thermus thermophilus HB8
PDB Compounds: (A:) putative mannose-1-phosphate guanylyl transferase

SCOPe Domain Sequences for d2cu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cu2a1 b.81.4.1 (A:269-335) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]}
dphenvvlgegrhvaldtfgcvvyadrgvvatlgvsglvvakvgdevlvvpkdwarevre
vvkrlea

SCOPe Domain Coordinates for d2cu2a1:

Click to download the PDB-style file with coordinates for d2cu2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cu2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cu2a2