SCOPe 2.08: Domain d2cu2a1: 2cu2 A:269-335

Lineage for d2cu2a1 (2cu2 A:269-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.4: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain [159283] (1 family)
   probable rudiment form of the LpxA-like hexapeptide domain

5. Family b.81.4.1: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain [159284] (1 protein)
   corresponds to the N-terminal part of Pfam PF01050, but does not extend to the conserved functional motif; the predicted cupin fold may reside in the rest of the Pfam domain
   this is a repeat family; one repeat unit is 2cu2 A:288-305 found in domain

6. Protein Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 [159285] (1 species)
   there is no the functional mannose-6-phosphate isomerase domain in this protein; this would-be the linker domain is the C-terminal one

7. Species Thermus thermophilus [TaxId:274] [159286] (1 PDB entry)
   Uniprot Q5SHI0 269-335

8. Domain d2cu2a1: 2cu2 A:269-335 [146426]
   Other proteins in same PDB: d2cu2a2
   complexed with so4

Details for d2cu2a1

PDB Entry: 2cu2, 2.2 Å

PDB Description: Crystal structure of mannose-1-phosphate geranyltransferase from Thermus thermophilus HB8

PDB Compounds: (A:) putative mannose-1-phosphate guanylyl transferase

SCOPe Domain Sequences for d2cu2a1:

Sequence; same for both SEQRES and ATOM records:

>d2cu2a1 b.81.4.1 (A:269-335) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]}
dphenvvlgegrhvaldtfgcvvyadrgvvatlgvsglvvakvgdevlvvpkdwarevre
vvkrlea

Timeline for d2cu2a1:

• d2cu2a1 first appeared in SCOP 1.75
  
• d2cu2a1 appears in SCOPe 2.07