SCOPe 2.08: Domain d2cu2a2: 2cu2 A:1-268

Lineage for d2cu2a2 (2cu2 A:1-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.20: mannose-1-phosphate guanylyl transferase [159720] (1 protein)
   automatically mapped to Pfam PF00483

6. Protein Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 [159721] (1 species)

7. Species Thermus thermophilus [TaxId:274] [159722] (1 PDB entry)
   Uniprot Q5SHI0 1-268

8. Domain d2cu2a2: 2cu2 A:1-268 [146427]
   Other proteins in same PDB: d2cu2a1
   complexed with so4

Details for d2cu2a2

PDB Entry: 2cu2, 2.2 Å

PDB Description: Crystal structure of mannose-1-phosphate geranyltransferase from Thermus thermophilus HB8

PDB Compounds: (A:) putative mannose-1-phosphate guanylyl transferase

SCOPe Domain Sequences for d2cu2a2:

Sequence; same for both SEQRES and ATOM records:

>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]}
mktyalvmaggrgerlwplsredrpkpflplfegktlleatlerlaplvppertllavrr
dqeavarpyadgirllleplgrdtagavllgvaealkegaerllvlpadhyvgddeayre
alatmleaaeegfvvalglrptrpeteygyirlgpregawyrgegfvekpsyaealeyir
kgyvwnggvfafapatmaelfrrhlpshhealerllagasleevyaglpkisidygvmek
aervrvvlgrfpwddvgnwralervfsq

Timeline for d2cu2a2:

• d2cu2a2 first appeared in SCOP 1.75
  
• d2cu2a2 appears in SCOPe 2.07