SCOPe 2.04: Domain d2co5b_: 2co5 B:

Lineage for d2co5b_ (2co5 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.48: F93-like [109674] (4 proteins)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein automated matches [190570] (1 species)
   not a true protein

7. Species Sulfolobus turreted icosahedral virus [TaxId:269145] [187561] (1 PDB entry)

8. Domain d2co5b_: 2co5 B: [146419]
   Other proteins in same PDB: d2co5a1
   automated match to d2co5a1
   protein/DNA complex

Details for d2co5b_

PDB Entry: 2co5, 2.2 Å

PDB Description: f93 from stiv, a winged-helix dna-binding protein

PDB Compounds: (B:) viral protein f93

SCOPe Domain Sequences for d2co5b_:

Sequence; same for both SEQRES and ATOM records:

>d2co5b_ a.4.5.48 (B:) automated matches {Sulfolobus turreted icosahedral virus [TaxId: 269145]}
mkirkymrinyyiilkvlvingsrlekkrlrseilkrfdidisdgvlyplidsliddkil
reeeapdgkvlfltekgmkefeelheffkkivch

Timeline for d2co5b_:

• d2co5b_ first appeared in SCOP 1.75, called d2co5b1
  
• d2co5b_ appears in SCOPe 2.03
  
• d2co5b_ appears in SCOPe 2.05
  
• d2co5b_ appears in the current release, SCOPe 2.08, called d2co5b2