SCOPe 2.05: Domain d2cjrb_: 2cjr B:

Lineage for d2cjrb_ (2cjr B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
   dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta

4. Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families)

5. Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
   C-terminal part of Pfam PF00937

6. Protein automated matches [190565] (2 species)
   not a true protein

7. Species Sars coronavirus [TaxId:229993] [187553] (1 PDB entry)

8. Domain d2cjrb_: 2cjr B: [146400]
   Other proteins in same PDB: d2cjra1
   automated match to d2cjra1

Details for d2cjrb_

PDB Entry: 2cjr, 2.5 Å

PDB Description: crystal structure of oligomerization domain of sars coronavirus nucleocapsid protein.

PDB Compounds: (B:) nucleocapsid protein

SCOPe Domain Sequences for d2cjrb_:

Sequence; same for both SEQRES and ATOM records:

>d2cjrb_ d.254.1.2 (B:) automated matches {Sars coronavirus [TaxId: 229993]}
aeaskkprqkrtatkqynvtqafgrrgpeqtqgnfgdqdlirqgtdykhwpqiaqfapsa
saffgmsrigmevtpsgtwltyhgaiklddkdpqfkdnvillnkhidayktfp

Timeline for d2cjrb_:

• d2cjrb_ first appeared in SCOP 1.75, called d2cjrb1
  
• d2cjrb_ appears in SCOPe 2.04
  
• d2cjrb_ appears in SCOPe 2.06
  
• d2cjrb_ appears in the current release, SCOPe 2.08