Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
Protein automated matches [190542] (1 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [187517] (3 PDB entries) |
Domain d2c7ib_: 2c7i B: [146376] automated match to d2arsa1 |
PDB Entry: 2c7i (more details), 2.1 Å
SCOPe Domain Sequences for d2c7ib_:
Sequence, based on SEQRES records: (download)
>d2c7ib_ d.104.1.3 (B:) automated matches {Thermoplasma acidophilum [TaxId: 273075]} megrlllletpgntrmslaydeaiyrsfqygdkpilrfyrhdrsviigyfqvaeeevdld ymkkngimlarrytgggavyhdlgdlnfsvvrssddmditsmfrtmneavvnslrilgld arpgelndvsipvnkktdimagekkimgaagamrkgaklwhaamlvhtdldmlsavlkvp dekfrdkiakstrervanvtdfvdvsidevrnalirgfsetlhidfredtitekeeslar elfdkkysteewnmgl
>d2c7ib_ d.104.1.3 (B:) automated matches {Thermoplasma acidophilum [TaxId: 273075]} megrlllletpgntrmslaydeaiyrsfqygdkpilrfyrhdrsviigyfqvaeeevdld ymkkngimlarrytgggavyhdlgdlnfsvvrssddmditsmfrtmneavvnslrilgld arpgelndvsipvnkktdimagekkimgaagamrkgaklwhaamlvhtdldmlsavlerv anvtdfvdvsidevrnalirgfsetlhidfredtitekeeslarelfdkkysteewnmgl
Timeline for d2c7ib_: