Lineage for d2br2s2 (2br2 S:192-275)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214221Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1214222Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 1214223Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 1214283Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 1214291Species Sulfolobus solfataricus [TaxId:2287] [160599] (7 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 1214304Domain d2br2s2: 2br2 S:192-275 [146202]
    Other proteins in same PDB: d2br2a1, d2br2b1, d2br2b2, d2br2c1, d2br2d1, d2br2d2, d2br2e1, d2br2f1, d2br2f2, d2br2g1, d2br2h1, d2br2h2, d2br2i1, d2br2j1, d2br2j2, d2br2k1, d2br2l1, d2br2l2, d2br2m1, d2br2n1, d2br2n2, d2br2o1, d2br2p1, d2br2p2, d2br2q1, d2br2r1, d2br2r2, d2br2s1, d2br2t1, d2br2t2, d2br2u1, d2br2v1, d2br2v2, d2br2w1, d2br2x1, d2br2x2
    automatically matched to 2JE6 A:192-275
    complexed with cl

Details for d2br2s2

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (S:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2br2s2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br2s2 d.101.1.1 (S:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d2br2s2:

Click to download the PDB-style file with coordinates for d2br2s2.
(The format of our PDB-style files is described here.)

Timeline for d2br2s2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2s1
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2