Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) |
Domain d2bnub2: 2bnu B:114-242 [146160] Other proteins in same PDB: d2bnua1, d2bnua2, d2bnub1 automated match to d2bnqe2 |
PDB Entry: 2bnu (more details), 1.4 Å
SCOPe Domain Sequences for d2bnub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnub2 b.1.1.2 (B:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d2bnub2: