SCOPe 2.06: Domain d2bnub2: 2bnu B:114-242

Lineage for d2bnub2 (2bnu B:114-242)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d2bnub2: 2bnu B:114-242 [146160]
   Other proteins in same PDB: d2bnua1, d2bnua2, d2bnub1
   automated match to d2bnqe2

Details for d2bnub2

PDB Entry: 2bnu, 1.4 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (B:) T-cell receptor beta chain c region

SCOPe Domain Sequences for d2bnub2:

Sequence; same for both SEQRES and ATOM records:

>d2bnub2 b.1.1.2 (B:114-242) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2bnub2:

• d2bnub2 first appeared in SCOP 1.75
  
• d2bnub2 appears in SCOPe 2.05
  
• d2bnub2 appears in SCOPe 2.07
  
• d2bnub2 appears in the current release, SCOPe 2.08