SCOP 1.75: Domain d2bngb1: 2bng B:13-144

Lineage for d2bngb1 (2bng B:13-144)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (2 proteins)

6. Protein Uncharacterized protein Mb2760 [159963] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [159964] (1 PDB entry)
   Uniprot Q7TY00 13-144

8. Domain d2bngb1: 2bng B:13-144 [146157]
   automatically matched to 2BNG A:13-144
   complexed with ca

Details for d2bngb1

PDB Entry: 2bng, 2.5 Å

PDB Description: structure of an m.tuberculosis leh-like epoxide hydrolase

PDB Compounds: (B:) mb2760

SCOP Domain Sequences for d2bngb1:

Sequence; same for both SEQRES and ATOM records:

>d2bngb1 d.17.4.8 (B:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]}
etteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqgrvg
fevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydmfkg
llrglvalvvps

Timeline for d2bngb1:

• d2bngb1 is new in SCOP 1.75
  
• d2bngb1 is called d2bngb_ in SCOPe 2.01
  
• d2bngb1 appears in the current release, SCOPe 2.08, called d2bngb_