Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (30 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (2 proteins) |
Protein Uncharacterized protein Mb2760 [159963] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [159964] (1 PDB entry) Uniprot Q7TY00 13-144 |
Domain d2bngb1: 2bng B:13-144 [146157] automatically matched to 2BNG A:13-144 complexed with ca |
PDB Entry: 2bng (more details), 2.5 Å
SCOP Domain Sequences for d2bngb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bngb1 d.17.4.8 (B:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} etteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqgrvg fevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydmfkg llrglvalvvps
Timeline for d2bngb1: