Lineage for d2bhma1 (2bhm A:97-235)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 856108Family d.17.4.26: VirB8-like [160029] (1 protein)
    Pfam PF04335
  6. 856109Protein Type IV secretion system protein VirB8 [160030] (2 species)
  7. 856113Species Brucella melitensis [TaxId:29459] [160032] (1 PDB entry)
    Uniprot Q7CEG3 97-235
  8. 856114Domain d2bhma1: 2bhm A:97-235 [146143]

Details for d2bhma1

PDB Entry: 2bhm (more details), 2.4 Å

PDB Description: crystal structure of virb8 from brucella suis
PDB Compounds: (A:) type IV secretion system protein virb8

SCOP Domain Sequences for d2bhma1:

Sequence, based on SEQRES records: (download)

>d2bhma1 d.17.4.26 (A:97-235) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpem

Sequence, based on observed residues (ATOM records): (download)

>d2bhma1 d.17.4.26 (A:97-235) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrgdgetthwiatigyqyvnpslmsesarltn
plgfnvtsyrvdpem

SCOP Domain Coordinates for d2bhma1:

Click to download the PDB-style file with coordinates for d2bhma1.
(The format of our PDB-style files is described here.)

Timeline for d2bhma1: