![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins) |
![]() | Protein Imidazolonepropionase [159348] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159349] (2 PDB entries) Uniprot P42084 3-73,374-415 |
![]() | Domain d2bb0a1: 2bb0 A:3-73,A:374-415 [146129] Other proteins in same PDB: d2bb0a2, d2bb0b2 complexed with act, zn |
PDB Entry: 2bb0 (more details), 2 Å
SCOPe Domain Sequences for d2bb0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bb0a1 b.92.1.10 (A:3-73,A:374-415) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} kqidtilinigqlltmessgpragksmqdlhviedavvgiheqkivfagqkgaeagyead eiidcsgrlvtXlkagrsadlviwqapnymyipyhygvnhvhqvmkngtivvnr
Timeline for d2bb0a1: