| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
| Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins) automatically mapped to Pfam PF13147 |
| Protein Imidazolonepropionase [159405] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [159406] (2 PDB entries) Uniprot P42084 74-373 |
| Domain d2bb0b2: 2bb0 B:74-373 [146132] Other proteins in same PDB: d2bb0a1, d2bb0b1 automated match to d2bb0a2 complexed with act, zn |
PDB Entry: 2bb0 (more details), 2 Å
SCOPe Domain Sequences for d2bb0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bb0b2 c.1.9.17 (B:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
pglvdphthlvfggsrekemnlklqgisyldilaqgggilstvkdtraaseeellqkahf
hlqrmlsygtttaevksgygleketelkqlrvakklhesqpvdlvstfmgahaippeyqn
dpddfldqmlsllpeikeqelasfadiftetgvftvsqsrrylqkaaeagfglkihadei
dplggaelagklkavsadhlvgtsdegikklaeagtiavllpgttfylgkstyararami
degvcvslatdfnpgsspteniqlimsiaalhlkmtaeeiwhavtvnaayaigkgeeagq
Timeline for d2bb0b2: