Lineage for d2ag8a2 (2ag8 A:1-152)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821720Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 821844Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species)
  7. 821845Species Neisseria meningitidis, serogroup B [TaxId:487] [117435] (2 PDB entries)
    Uniprot Q9K1N1
  8. 821847Domain d2ag8a2: 2ag8 A:1-152 [146054]
    Other proteins in same PDB: d2ag8a1
    automatically matched to 1YQG A:1-152
    complexed with nap

Details for d2ag8a2

PDB Entry: 2ag8 (more details), 2.1 Å

PDB Description: NADP complex of Pyrroline-5-carboxylate reductase from Neisseria meningitidis
PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOP Domain Sequences for d2ag8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ag8a2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddv
lilavkpqdmeaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglg
vsgmyaeaevsetdrriadrimksvgltvwld

SCOP Domain Coordinates for d2ag8a2:

Click to download the PDB-style file with coordinates for d2ag8a2.
(The format of our PDB-style files is described here.)

Timeline for d2ag8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ag8a1