SCOPe 2.01: Domain d2ag8a2: 2ag8 A:1-152

Lineage for d2ag8a2 (2ag8 A:1-152)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species)

7. Species Neisseria meningitidis, serogroup B [TaxId:487] [117435] (2 PDB entries)
   Uniprot Q9K1N1

8. Domain d2ag8a2: 2ag8 A:1-152 [146054]
   Other proteins in same PDB: d2ag8a1
   automatically matched to 1YQG A:1-152
   complexed with nap

Details for d2ag8a2

PDB Entry: 2ag8, 2.1 Å

PDB Description: NADP complex of Pyrroline-5-carboxylate reductase from Neisseria meningitidis

PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d2ag8a2:

Sequence; same for both SEQRES and ATOM records:

>d2ag8a2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddv
lilavkpqdmeaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglg
vsgmyaeaevsetdrriadrimksvgltvwld

Timeline for d2ag8a2:

• d2ag8a2 first appeared in SCOP 1.75
  
• d2ag8a2 appears in SCOPe 2.02
  
• d2ag8a2 appears in the current release, SCOPe 2.08