| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.2: NTF2-like [54431] (6 proteins) |
| Protein Nuclear transport factor-2 (NTF2) [54432] (4 species) |
| Species Cryptosporidium parvum [TaxId:5807] [159958] (1 PDB entry) Uniprot Q5CQI4 4-127 |
| Domain d1zo2a1: 1zo2 A:10-126 [146021] Other proteins in same PDB: d1zo2b_ |
PDB Entry: 1zo2 (more details), 1.6 Å
SCOPe Domain Sequences for d1zo2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}
fdqigkqfvqhyyqtfqtnrpalgglygpqsmltwedtqfqgqanivnkfnslnfqrvqf
eitrvdcqpspnngsivfvtgdvriddgqplkfsqvfnlmpsgnggfmifndlfrln
Timeline for d1zo2a1: