Lineage for d1zo2a1 (1zo2 A:10-126)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020063Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1020085Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)
  7. 1020095Species Cryptosporidium parvum [TaxId:5807] [159958] (1 PDB entry)
    Uniprot Q5CQI4 4-127
  8. 1020096Domain d1zo2a1: 1zo2 A:10-126 [146021]
    Other proteins in same PDB: d1zo2b_

Details for d1zo2a1

PDB Entry: 1zo2 (more details), 1.6 Å

PDB Description: structure of nuclear transport factor 2 (ntf2) from cryptosporidium parvum
PDB Compounds: (A:) nuclear transport factor 2

SCOPe Domain Sequences for d1zo2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]}
fdqigkqfvqhyyqtfqtnrpalgglygpqsmltwedtqfqgqanivnkfnslnfqrvqf
eitrvdcqpspnngsivfvtgdvriddgqplkfsqvfnlmpsgnggfmifndlfrln

SCOPe Domain Coordinates for d1zo2a1:

Click to download the PDB-style file with coordinates for d1zo2a1.
(The format of our PDB-style files is described here.)

Timeline for d1zo2a1: