Lineage for d1zhoe1 (1zho E:5-228)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019720Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 3019721Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 3019722Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 3019723Protein Ribosomal protein L1 [56810] (4 species)
  7. 3019734Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 3019739Domain d1zhoe1: 1zho E:5-228 [146001]
    automatically matched to 1YL3 C:5-228
    protein/RNA complex; complexed with k

Details for d1zhoe1

PDB Entry: 1zho (more details), 2.6 Å

PDB Description: The structure of a ribosomal protein L1 in complex with mRNA
PDB Compounds: (E:) 50s ribosomal protein l1

SCOPe Domain Sequences for d1zhoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhoe1 e.24.1.1 (E:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOPe Domain Coordinates for d1zhoe1:

Click to download the PDB-style file with coordinates for d1zhoe1.
(The format of our PDB-style files is described here.)

Timeline for d1zhoe1: