PDB entry 1zho

View 1zho on RCSB PDB site
Description: The structure of a ribosomal protein L1 in complex with mRNA
Class: structural protein/RNA
Keywords: ribosome, ribosomal protein, mRNA-protein complex, l1, regulation of gene expression, RNA-protein interaction, structural protein/RNA complex
Deposited on 2005-04-26, released 2006-05-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Gene: rplA, rpl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27150 (0-227)
      • modified residue (107)
      • modified residue (119)
      • modified residue (217)
    Domains in SCOPe 2.08: d1zhoa1
  • Chain 'B':
    Compound: mRNA
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Gene: rplA, rpl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27150 (0-227)
      • modified residue (107)
      • modified residue (119)
      • modified residue (217)
    Domains in SCOPe 2.08: d1zhoc1
  • Chain 'D':
    Compound: mRNA
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Gene: rplA, rpl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27150 (0-227)
      • modified residue (107)
      • modified residue (119)
      • modified residue (217)
    Domains in SCOPe 2.08: d1zhoe1
  • Chain 'F':
    Compound: mRNA
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Gene: rplA, rpl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27150 (0-227)
      • modified residue (107)
      • modified residue (119)
      • modified residue (217)
    Domains in SCOPe 2.08: d1zhog1
  • Chain 'H':
    Compound: mRNA
    Species: synthetic, synthetic
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhoA (A:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
    gavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
    ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhoC (C:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
    gavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
    ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhoE (E:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
    gavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
    ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zhoG (G:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvm
    gavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasf
    ppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

  • Chain 'H':
    No sequence available.