Lineage for d1zbbb1 (1zbb B:24-102)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725987Protein Histone H4 [47125] (7 species)
  7. 1725988Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries)
  8. 1726067Domain d1zbbb1: 1zbb B:24-102 [145986]
    Other proteins in same PDB: d1zbba1, d1zbbd1, d1zbbe1
    automatically matched to d1p3ob_
    protein/DNA complex

Details for d1zbbb1

PDB Entry: 1zbb (more details), 9 Å

PDB Description: Structure of the 4_601_167 Tetranucleosome
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1zbbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbbb1 a.22.1.1 (B:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1zbbb1:

Click to download the PDB-style file with coordinates for d1zbbb1.
(The format of our PDB-style files is described here.)

Timeline for d1zbbb1: